ABclonal
Recombinant Mouse CCL22/MDC Protein - RP01906
Recombinant Mouse CCL22/MDC Protein - RP01906
Couldn't load pickup availability
Recombinant Mouse CCL22/MDC Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01906-10, RP01906-20, RP01906-50, RP01906-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL22/MDC Protein by Pichia expression system. The target protein is expressed with sequence (Gly25-Ser92) of Mouse CCL22/MDC (Accession #NP_033163.1) fused with a His tag at the C-terminus..
Alternate Names: Ccl22, Abcd1, Scya22, C-C motif chemokine 22, Activated B and dendritic cell-derived, CC chemokine ABCD-1, Small-inducible cytokine A22
SWISS: O88430
GeneID: 20299
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CCL22 may play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Also, it is a chemotactic for monocytes. dendritic cells and natural killer cells. CCL22 is a mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemattractant activity for neutrophils, eosinophils, and resting T-lymphocytes.
Source: Pichia
Tag: C-His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS, 0.2 M Arginine, pH7.4. Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
