ABclonal
Recombinant Mouse CCL3/MIP-1 alpha Protein - RP00714
Recombinant Mouse CCL3/MIP-1 alpha Protein - RP00714
Couldn't load pickup availability
Recombinant Mouse CCL3/MIP-1 alpha Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00714-10, RP00714-20, RP00714-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL3/MIP-1 alpha Protein is produced by CHO cells expression system. The target protein is expressed with sequence (Ala24-Ala92) of Mouse CCL3/MIP-1 alpha (Accession # NP_035467.1) fused with His tag at the C-terminus.
Alternate Names: Ccl3, Mip1a, Scya3, C-C motif chemokine 3, MIP-1-alpha, SIS-alpha,
SWISS: P10855
GeneID: 20302
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)
Source: CHO Cells
Tag: C-His
Formulation: Lyophilized from 0.22μm filtered solution in 50mM Acetate-sodium acetate pH3.6.
Antigen Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
