Skip to product information
1 of 1

ABclonal

Recombinant Mouse CCL3/MIP-1 alpha Protein - RP00714

Recombinant Mouse CCL3/MIP-1 alpha Protein - RP00714

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CCL3/MIP-1 alpha Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00714-10, RP00714-20, RP00714-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CCL3/MIP-1 alpha Protein is produced by CHO cells expression system. The target protein is expressed with sequence (Ala24-Ala92) of Mouse CCL3/MIP-1 alpha (Accession # NP_035467.1) fused with His tag at the C-terminus.

Alternate Names: Ccl3, Mip1a, Scya3, C-C motif chemokine 3, MIP-1-alpha, SIS-alpha,

SWISS: P10855

GeneID: 20302

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)

Source: CHO Cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in 50mM Acetate-sodium acetate pH3.6.

Antigen Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details