Skip to product information
1 of 1

ABclonal

Recombinant Mouse CCL4/MIP-1β Protein - RP01907

Recombinant Mouse CCL4/MIP-1β Protein - RP01907

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CCL4/MIP-1β Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01907-10, RP01907-20, RP01907-50, RP01907-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Mouse CCL4/MIP-1β Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala24-Asn92) of Mouse CCL4/MIP-1β (Accession #NP_038680.1) fused with a His tag at the C-terminus.

Alternate Names: Ccl4, Mip1b, Scya4, C-C motif chemokine 4, Immune activation protein 2, ACT-2, ACT2, Macrophage inflammatory protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible cytokine A4

SWISS: P14097

GeneID: 20303

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CCL4, also known as macrophage inflammatory protein 1 beta (MIP-1 beta ), is a 12 kDa beta chemokine that is secreted at sites of inflammation by activated leukocytes, lymphocytes, vascular endothelial cells, and pulmonary smooth muscle cells. CCL4 attracts a variety of immune cells to sites of microbial infection as well as to other pathologic inflammation such as allergic asthma and ischemic myocardium. A CCL4 deficiency in mice promotes the development of autoantibodies, possibly as a result of compromised regulatory T cell recruitment. CCL4 is secreted from activated monocytes as a heterodimer with CCL3/MIP-1 alpha. The first two N-terminal amino acids can be cleaved from human CCL4 by CD26/DPPIV. Both the full length and truncated forms exert biological activity through CCR5, Both forms of CCL4 block HIV-1 infection of T cells by inducing the downregulation of CCR5.

Source: Pichia

Tag: C-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details