Skip to product information
1 of 2

Elabscience

Recombinant Mouse CCL4 protein(N-His)(active) - PKSM041505

Recombinant Mouse CCL4 protein(N-His)(active) - PKSM041505

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CCL4 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSM041505-20, PKSM041505-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: CCL4

Target Symptom: 4-1BB; 4-1BB-; 4-1BB-L; 4-1BBL; AI848817; Cd137; Cd137l; Ly6; Ly63l; tumor necrosis factor (ligand) superfamily; member 9; Tnfsf9

Target Species: Mouse

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P14097

Accession: P14097

Background: CCL4 (C-C chemokine ligand 4), is a macrophage inflammatory protein with a chief effect in inflammation and immune-regulation, and was documented in cancer progression by promoting instability in the tumor environment. The inflammatory chemokine (C-C motif) ligand 4 (CCL4) plays an important role in the pathogenesis and progression of cancer. In particular, higher serum CCL4 levels in patients with oral squamous cell carcinoma (OSCC) are associated with a more advanced stage of disease. CCL4 may be a new molecular therapeutic target for inhibition of lymphangiogenesis and metastasis in OSCC. CCL3 and CCL4 loci may be marker SNPs for risk of HCV treatment outcome. CCL4 can enhance the recruitment of preosteoclasts to bone in the early stage, and the reduction of CCR5 promotes osteoclastogenesis when RANKL is prevalent.

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is < 4 ng/mL.

Sequence: MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 10.99 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details