ABclonal
Recombinant Mouse CCL6 Protein - RP01716
Recombinant Mouse CCL6 Protein - RP01716
Couldn't load pickup availability
Recombinant Mouse CCL6 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01716-10, RP01716-20, RP01716-50, RP01716-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly22 - Ala116) of mouse CCL6 (Accession #NP_033165.1.) fused with and a 6×His tag at the C-terminus.
Alternate Names: c10; MRP-1; Scya6; CCL6
SWISS: P27784
GeneID: 20305
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Chemokine (C-C motif) ligand 6 (CCL6), also known as C-C chemokine C10 has only been identified in rodents, which is a small cytokine belonging to the CC chemokine family, beta-chemokine subfamily. C-C chemokine C10 is involved in the chronic stages of host defense reactions. C10 chemokine rapidly promotes disease resolution in the cecal ligation and puncture (CLP) model through its direct effects on the cellular events critically involved in host defense during septic peritonitis. CCL6 appears to contribute to the macrophage infiltration that is independent of other CC chemokines. C10 is a prominent chemokine expressed in the central nervous system in experimental inflammatory demyelinating disease, also acts as a potent chemotactic factor for the migration of these leukocytes to the brain. CCL6 may be a mediator released by microglia for cell-cell communication under physiological as well as pathological conditions of CNS. Additionally, the chemokine CCL6 may alter tumor behavior by relieving its growth factor dependency and by promoting invasiveness as a result of local tissue apoptosis.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
