ABclonal
Recombinant Mouse CCL7/MCP-3 Protein - RP01923
Recombinant Mouse CCL7/MCP-3 Protein - RP01923
Couldn't load pickup availability
Recombinant Mouse CCL7/MCP-3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01923-10, RP01923-20, RP01923-50, RP01923-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL7/MCP-3 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro97) of Mouse CCL7/MCP-3 (Accession #NP_038682.1) fused with a his tag at the N-terminus.
Alternate Names: C-C motif chemokine 7; CCL7; chemokine (C-C motif) ligand 7; FIC; MARC; MCP-3; MCP3Monocyte chemotactic protein 3; MCP-3Small-inducible cytokine A7; MGC138465; Monocyte chemoattractant protein 3; NC28SCYA6; SCYA7MGC138463; small inducible cytokine A7 (monocyte chemotactic protein 3)
SWISS: Q03366
GeneID: 20306
Species: Mouse
Purity: ≥ 95% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Mouse CCL7/MCP-3, a member of the beta subfamily of chemokines, was initially identified as a transcript that is induced in a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen.Mouse MARC/MCP-3 expression has also been detected during murine experimental allergic encephalomyelitis in the spinal cord, and in LPS-stimulated murine WEHI -3 cells and Swiss 3T3 cells where MARC expression is glucocorticoid-attenuated. Except for one amino acid subsititution, mouse MARC is identical to mouse FIC, the product of a growth factor-activated gene. Mouse CCR2, a mouse chemokine receptor, has been shown to bind JE/MCP-1 with high affinity and MARC/MCP-3 with lower affinity.
Source: Pichia
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
