ABclonal
Recombinant Mouse CCL8/MCP-2 Protein - RP00773
Recombinant Mouse CCL8/MCP-2 Protein - RP00773
Couldn't load pickup availability
Recombinant Mouse CCL8/MCP-2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00773-10, RP00773-20, RP00773-50, RP00773-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CCL8/MCP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gly24-Pro97) of mouse CCL8/MCP-2 (Accession #Q9Z121) fused with a 6×His tag at the C-terminus.
Alternate Names: C-C motif chemokine 8; Ccl8; Monocyte chemoattractant protein 2; Monocyte chemotactic protein2; MCP-2; Small-inducible cytokine A8; Mcp2; Scya8
SWISS: Q9Z121
GeneID: 20307
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Chemokine ligand 8 (CCL8,MCP-2), is a small secreted cytokine which belongs to the intercrine beta(chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions toactivate different immune cells, including mast cells, eosinophils and basophils which are involved in allergicresponses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its abilityachieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B andCCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is oneof the major co-receptors for HIV-1.
Source: Pichia
Tag: C-6×His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
