Skip to product information
1 of 1

ABclonal

Recombinant Mouse CD28 Protein - RP01211

Recombinant Mouse CD28 Protein - RP01211

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CD28 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01211-10, RP01211-20, RP01211-50, RP01211-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn20-Lys149) of mouse CD28 (Accession #NP_031668.3) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: CD28, Tp44, CD28

SWISS: P31041

GeneID: 12487

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Mouse CD86 Protein at 5 μg/mL (100 μL/well) can bind Mouse CD28 with a linear range of 0.0012-1.154 μg/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details