Recombinant Mouse CD47 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00711-10, RP00711-20, RP00711-50, RP00711-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CD47 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with an Fc tag at the C-terminus.
Alternate Names: Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-AssociatedProtein, IAP, Protein MER6, CD47, MER6
SWISS: Q61735-1
GeneID: 16423
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, andC‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Antigen Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only