WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse CD5 Protein - RP01500

Recombinant Mouse CD5 Protein - RP01500

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse CD5 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01500-10, RP01500-20, RP01500-50, RP01500-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Pro371) of mouse CD5/Lyt1 (Accession #NP_031676.3) fused with a 6×His tag at the C-terminus.

Alternate Names: LEU1, T1, CD5

SWISS: P13379

GeneID: 12507

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only