ABclonal
Recombinant Mouse Clusterin/Apo-J/CLU Protein - RP01604
Recombinant Mouse Clusterin/Apo-J/CLU Protein - RP01604
Couldn't load pickup availability
Recombinant Mouse Clusterin/Apo-J/CLU Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01604-10, RP01604-20, RP01604-50, RP01604-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Clusterin/Apo-J/CLU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Glu448) of mouse Clusterin/Apo-J/CLU (Accession #NP_038520.2) fused with and a 6×His tag at the C-terminus.
Alternate Names: AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2, CLU
SWISS: Q06890
GeneID: 12759
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GEQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
