Skip to product information
1 of 1

ABclonal

Recombinant Mouse Cripto/TDGF1 Protein - RP01946

Recombinant Mouse Cripto/TDGF1 Protein - RP01946

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Cripto/TDGF1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01946-10, RP01946-20, RP01946-50, RP01946-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Cripto/TDGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg26-Gln150) of Mouse Cripto/TDGF1(Accession #NP_035692.2) fused with a His tag at the C-terminus.

Alternate Names: Cripto, Tdgf1, Teratocarcinoma-derived growth factor, Cripto growth factor, Epidermal growth factor-like Cripto protein

SWISS: P51865

GeneID: 21667

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details