ABclonal
Recombinant Mouse CSF-2/GM-CSF Protein - RP01206
Recombinant Mouse CSF-2/GM-CSF Protein - RP01206
Couldn't load pickup availability
Recombinant Mouse CSF-2/GM-CSF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01206-10, RP01206-20, RP01206-50, RP01206-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CSF-2/GM-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Lys141) of mouse GM-CSF/CSF2 (Accession #NP_034099.2) fused with a 6×His tag at the N-terminus.
Alternate Names: GMCSF, CSF2
SWISS: P01587
GeneID: 12981
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Granulocyte-macrophage colony-stimulating factor (GM-CSF) is also known as Colony stimulating factor 2 (granulocyte-macrophage), is a cytokine initially characterized by its ability to induce colonies of granulocytes and macrophages from myeloid progenitor cells, and is secreted by macrophages, T cells, mast cells, endothelial cells and fibroblasts. GM-CSF is a cytokine that functions as a white blood cell growth factor. GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes. Monocytes exitthe circulation and migrate into tissue, whereupon they mature into macrophages and dendritic cells. Thus, it is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection. The active form of the protein is found extracellularly as a homodimer. Human GM-CSF glycosylated in its mature form. As a part of the immune/inflammatory cascade, GM-CSF promotes Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity, and thus worthy of consideration for therapeutic target. GM-CSF has also recently been evaluated in clinical trials for its potential as a vaccine adjuvant in HIV-infected patients. The preliminary results have been promising. GM-CSF is also used as a medication to stimulate the production of white blood cells following chemotherapy.
Bio-Activity: Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is typically 0.04-0.17 ng/mL, corresponding to a specific activity of 5.88×10^6 ~2.5×10^7 units/mg.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
