Skip to product information
1 of 1

ABclonal

Recombinant Mouse CSF-3/G-CSF Protein - RP00573

Recombinant Mouse CSF-3/G-CSF Protein - RP00573

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CSF-3/G-CSF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00573-10, RP00573-20, RP00573-50, RP00573-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CSF-3/G-CSF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Met1-Ala208) of mouse G-CSF/CSF3 (Accession #P09920) fused with a 6×His tag at the C-terminus.

Alternate Names: Granulocyte colony-stimulating factor; Csf3; G-CSF

SWISS: P09920

GeneID: 12985

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to theIL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesisby controlling the production, differentiation, and function of 2 related white cell populations of the blood, thegranulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to thecytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and twofibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have beendemonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluatedas a stem cell mobilizer and erythropoietin as a cytoprotective agent.

Bio-Activity: Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 38.7-154.8 pg/mL, corresponding to a specific activity of 6.46×10^6 -2.58×10^7 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details