Skip to product information
1 of 1

ABclonal

Recombinant Mouse CSF1R/M-CSF R/CD115 Protein - RP01554

Recombinant Mouse CSF1R/M-CSF R/CD115 Protein - RP01554

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CSF1R/M-CSF R/CD115 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01554-10, RP01554-20, RP01554-50, RP01554-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CSF1R/M-CSF R/CD115 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala20-Ser511) of mouse CSF1R/M-CSF R/CD115 (Accession #NP_001032948.2) fused with a 6×His tag at the C-terminus.

Alternate Names: C-FMS , CD115 , CSF-1R , CSFR , FIM2 , FMS , HDLS , M-CSF-R , MCSF Receptor, CSF1R

SWISS: P09581

GeneID: 12978

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The recombinant human CSF1R/GST chimera consists of 667 amino acids with a molecular weight of 76 KDa. It migrates as an about 75 KDa band in SDS-PAGE under reducing conditions.M-CSFR encoded by the proto-oncogene c-fms is the receptor for colony stimulating factor 1 (CSF1R), a cytokine involved in the proliferation, differentiation, and activation of macrophages.This cell surface glycoprotein is consisted by an extracellular ligand-binding domain, a single membrane-spanning segment, and an intracellular tyrosine kinase domain. CSF1R is a receptor for a cytokine called colony stimulating factor 1, The protein encoded by the CSFR1 gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most, if not all, of the biological effects of this cytokine. Ligand binding activates CSFR1 through a process of oligomerization and transphosphorylation. Mutations in CSF1R are associated with chronic myelomonocytic leukemia and type M4 acute myeloblastic leukemia. Increased levels of CSF1R1 are found in microglia in Alzheimer’s disease and after brain injuries. The role of CSF1 and CSF1R in normal and neoplastic mammary development that may elucidate potential relationships of growth factor-induced biological changes in the breast during pregnancy and tumor progression.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details