Skip to product information
1 of 1

ABclonal

Recombinant Mouse CTLA-4/CD152 Protein - RP01326

Recombinant Mouse CTLA-4/CD152 Protein - RP01326

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CTLA-4/CD152 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01326-10, RP01326-20, RP01326-50, RP01326-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CTLA-4/CD152 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu36-Asp161) of Mouse CTLA4 (Accession #NP_033973.2) fused with an 6×His tag at the C-terminus.

Alternate Names: Cd152, Ctla-4, Ly-56, CTLA4

SWISS: P09793

GeneID: 12477

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cytotoxic T-lymphocyte protein 4, also known as CTLA4 and CD152, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor family,and is similar to the T-cell co-stimulatory protein, CD28, both molecules bind to CD80 and CD86, also called B7-1 and B7-2 respectively, on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.Intracellular CTLA4 is also found in regulatory T cells, CD152 or cytotoxic T lymphocyte antigen-4 (CTLA-4) is an essential receptor involved in the negative regulation of T cell activation. Because of its profound inhibitory role, CD152 has been considered a sound susceptible candidate in autoimmunity and a persuasive target for cancer immunotherapy.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse CTLA-4/CD152 at 2μg/mL (100μL/well) can bind Mouse B7-2/CD86 with a linear range of 0.1-51.8 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTV GFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPE PCPDSD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details