Recombinant Mouse CXCL1/GRO-alpha Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01615-10, RP01615-20, RP01615-50, RP01615-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CXCL1/GRO-alpha Protein is produced by Pichia expression system. The target protein is expressed with sequence (Arg20-Lys96) of mouse CXCL1/GRO-alpha (Accession #NP_032202.1) fused with no additional amino acid.
Alternate Names: FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1, CXCL1
SWISS: P12850
GeneID: 14825
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse CXCL1 at 2μg/mL (100 μL/well) can bind GRO alpha Rabbit pAb with a linear range of 0.6-2.37 ng/mL.
Source: Pichia
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only