Skip to product information
1 of 1

ABclonal

Recombinant Mouse CXCL10/IP-10 Protein - RP01625

Recombinant Mouse CXCL10/IP-10 Protein - RP01625

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CXCL10/IP-10 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01625-10, RP01625-20, RP01625-50, RP01625-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CXCL10/IP-10 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile22-Pro98) of mouse CXCL10/IP-10 (Accession #NP_067249.1) fused with no additional amino acid.

Alternate Names: C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10, CXCL10

SWISS: P17515

GeneID: 15945

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: C-X-C motif ligand 10 (CXCL10), or interferon-inducible protein-10, is a small chemokine belonging to the CXC chemokine family. Its members are responsible for leukocyte trafficking and act on tissue cells, like endothelial and vascular smooth muscle cells. CXCL10 is secreted by leukocytes and tissue cells and functions as a chemoattractant, mainly for lymphocytes.

Source: Pichia

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details