ABclonal
Recombinant Mouse CXCL10/IP-10 Protein - RP01625
Recombinant Mouse CXCL10/IP-10 Protein - RP01625
Couldn't load pickup availability
Recombinant Mouse CXCL10/IP-10 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01625-10, RP01625-20, RP01625-50, RP01625-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CXCL10/IP-10 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile22-Pro98) of mouse CXCL10/IP-10 (Accession #NP_067249.1) fused with no additional amino acid.
Alternate Names: C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10, CXCL10
SWISS: P17515
GeneID: 15945
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: C-X-C motif ligand 10 (CXCL10), or interferon-inducible protein-10, is a small chemokine belonging to the CXC chemokine family. Its members are responsible for leukocyte trafficking and act on tissue cells, like endothelial and vascular smooth muscle cells. CXCL10 is secreted by leukocytes and tissue cells and functions as a chemoattractant, mainly for lymphocytes.
Source: Pichia
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
