Elabscience
Recombinant Mouse CXCL10 protein(N-His)(active) - PKSM041503
Recombinant Mouse CXCL10 protein(N-His)(active) - PKSM041503
Couldn't load pickup availability
Recombinant Mouse CXCL10 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041503-20, PKSM041503-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL10
Target Symptom: IFNB1; Type I Interferon
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P17515
Accession: P17515
Background: Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types; such as monocytes; endothelial cells and fibroblasts; in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles; such as chemoattraction for activated T-lymphocytes; inhibition of angiogenesis; and antitumor activity.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 0.2 μg/mL.
Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 8.7 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
