Elabscience
Recombinant Mouse CXCL11 protein(N-His)(active) - PKSM041519
Recombinant Mouse CXCL11 protein(N-His)(active) - PKSM041519
Couldn't load pickup availability
Recombinant Mouse CXCL11 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041519-20, PKSM041519-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL11
Target Symptom: Epithelial Neutrophil Activating Peptide-78; ENA-78; AMCF; AMCF-II; Cxcl; Cxcl6; LIX; Scyb; Scyb5; Scyb6
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: Q9JHH5
Accession: Q9JHH5
Background: CXCL11, also known as I-TAC, SCYB9B, H174 and beta -R1, is a non-ELR CXC chemokine. CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-gamma and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T cells, neutrophils or monocytes. The gene encoding CXCL11 has been mapped to chromosome 4.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 10 ng/mL.
Sequence: MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 12.09 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
