Recombinant Mouse CXCL16/SR-PSOX Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01061-20, RP01061-50, RP01061-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CXCL16/SR-PSOX Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asn27-Trp201) of mouse CXCL16 (Accession #NP_075647.3) fused with a 6×His tag at the C-terminus.
Alternate Names: CXCL16, CXCLG16, SCYB16, SR-PSOX, CXCL16
SWISS: Q8BSU2
GeneID: 66102
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAW
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only