ABclonal
Recombinant Mouse CXCL2/MIP-2 Protein - RP01882
Recombinant Mouse CXCL2/MIP-2 Protein - RP01882
Couldn't load pickup availability
Recombinant Mouse CXCL2/MIP-2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01882-10, RP01882-20, RP01882-50, RP01882-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CXCL2/MIP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala28-Asn100) of Mouse CXCL2/MIP-2 (Accession #NP_033166.1) fused with a His tag at the C-terminus.
Alternate Names: Cxcl2, Mip-2, Mip2, Scyb2, C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2
SWISS: P10889
GeneID: 20310
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Macrophage Inflammatory Protein-2 (MIP-2) was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. Based on its protein and DNA sequences, MIP-2 is a member of the alpha (C-X-C) subfamily of chemokines.MIP-2 cDNA encodes a 100 amino acid residue precursor protein from which the amino-terminal 27 amino acid residues are cleaved to generate the mature MIP-2. The protein sequence of murine MIP-2 shows approximately 63% identity to that of murine KC, another murine alpha chemokine whose expression is induced by PDGF. In addition, the protein sequence of MIP-2 is also 60% identical to human GRO beta and GRO gamma. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs.Similarly to other alpha chemokines, murine MIP-2 is a potent neutrophil attractant and activator. MIP-2 and KC can bind the murine interleukin 8 type B receptor homologue with high affinity. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.
Source: Pichia
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
