Recombinant Mouse CXCL4/PF-4 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01924-10, RP01924-20, RP01924-50, RP01924-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Recombinant Mouse CXCL4/PF-4 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Val30-Ser105) of Mouse CXCL4/PF-4 (Accession #NP_064316.1) fused with a His tag at the C-terminus.
Alternate Names: Pf4, Cxcl4, Scyb4, Platelet factor 4, PF-4, C-X-C motif chemokine 4
SWISS: Q9Z126
GeneID: 56744
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CXCL4/PF-4,Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation. Acts via different functional receptors including CCR1, CXCR3A or CXCR3B. Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling. Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence. Chemotactic for neutrophils and monocytes via CCR1. Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis. In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition.
Source: Pichia
Tag: C-His
Formulation: Lyophilized from 0.22 μm filtered solution in 20mM pb,150mM Nacl ,1mM EDTA (pH 6.0). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only