Recombinant Mouse CXCL4/PF-4 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01953-10, RP01953-20, RP01953-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse CXCL4/PF-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val30-Ser105)of Mouse CXCL4/PF-4 (Accession #NP_064316.1) fused with a His tag at the C-terminus.
Alternate Names: Pf4, Cxcl4, Scyb4, Platelet factor 4, PF-4, C-X-C motif chemokine 4
SWISS: Q9Z126
GeneID: 56744
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only