Recombinant Mouse CXCL7 (40-113) protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041515-20, PKSM041515-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL7
Target Symptom: MIP-1b: Macrophage Inflammatory Protein-1β; ACT-2
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: Q9EQI5
Accession: Q9EQI5
Background: Human Chemokine (C-X-C motif) Ligand 7 (CXCL7); also known as neutrophil activating peptide 2 (NAP-2); is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines; such as IL-8 and the GRO proteins; CXCL7 binds CXCR2; chemoattracts and activates neutrophils. CXCL7; Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG); are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII; βTG; and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains; these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 1 μg/mL.
Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 13.08 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only