Skip to product information
1 of 1

ABclonal

Recombinant Mouse CXCL9/MIG Protein - RP02851

Recombinant Mouse CXCL9/MIG Protein - RP02851

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse CXCL9/MIG Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP02851-10, RP02851-20, RP02851-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse CXCL9/MIG Protein is produced by Pichia expression system. The target protein is expressed with sequence (Thr 22-Thr 126) of mouse CXCL9/MIG (Accession #NP_032625.2) fused with a His tag at the C-terminus..

Alternate Names: Mig; Scyb9

SWISS: P18340

GeneID: 17329

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Chemokine (C-X-C motif) ligand 9 (CXCL9), also known as Monokine induced by gamma interferon (MIG), is a small cytokine belonging to the CXC chemokine family. The function of this chemokine has not been specifically defined; however, it is thought to be involved in T cell trafficking. CXCL9/MIG functions as one of the three ligands of chemokine receptor CXCR3 which is a G protein-coupled receptor found predominantly on T cells. CXCL9/MIG, together with CXCL10 and CXCL11, may activate CXCR3 by binding to it. CXCL9 serves as a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. It has been observed that tumour endothelial cells secrete high levels of CXCL9 in all, and CXCL10 in most melanoma metastases. Experiment data represent novel mechanisms by which tumour cells in melanoma metastases might use the chemokine-expressing endothelium to leave the tumour and eventually to form additional metastases at distinct sites. Experiment results also improved that CXCL9/MIG plays an important role in CD4+ T lymphocyte recruitment and development of CAV, MOMA-2+ macrophages are the predominant recipient-derived source of CXCL9/MIG, and recipient CD4 lymphocytes are necessary for sustained CXCL9/MIG production and CAV development in this model. Neutralization of the chemokine CXCL9/MIG may have therapeutic potential for the treatment of chronic rejection after heart transplantation.

Source: Pichia

Tag: C-His

Formulation: Lyophilized from sterile PBS, pH 7.4

Antigen Sequence: MTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANV KKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Endotoxin: Please contact us for more information.

Research Use Only

View full details