Recombinant Mouse Dkk-1 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01062-10, RP01062-20, RP01062-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Dkk-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-His272) of mouse Dkk-1 (Accession #NP_034181.2. ) fused with a 6×His tag at the C-terminus.
Alternate Names: DKK1, SK, Dickkopf-1, DKK1, DKK1, SK, DKK1
SWISS: O54908
GeneID: 13380
Species: Mouse
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse DKK-1 at 5 μg/mL (100 μL/well) can bind Human LRP-5 with a linear range of 1-399 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only