Recombinant Mouse EGF Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01684-50, RP01684-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse EGF Protein is produced by Pichia expression system. The target protein is expressed with sequence (Asn977-Arg1029) of mouse EGF (Accession #NP_034243.2) fused with no additional amino acid.
Alternate Names: beta-urogastrone, EGF, epidermal growth factor (beta-urogastrone), epidermal growth factor, HOMG4, pro-epidermal growth factor, URG, Urogastrone
SWISS: P01132
GeneID: 13645
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: EGF is the founding member of the EGF-family of proteins. Members of this protein family have highly similar structural and functional characteristics. EGF contains 9 EGF-like domains and 9 LDL-receptor class B repeats. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds. As a low-molecular-weight polypeptide, EGF was first purified from the mouse submandibular gland, but since then it was found in many human tissues including submandibular gland, parotid gland.
Bio-Activity: Measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 37-148 pg/mL, corresponding to a specific activity of 7.14×10^6 ~2.50×10^7 units/mg.
Source: Pichia
Tag: No-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only