Skip to product information
1 of 1

ABclonal

Recombinant Mouse Endoglin/ENG/CD105 Protein - RP01912

Recombinant Mouse Endoglin/ENG/CD105 Protein - RP01912

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Endoglin/ENG/CD105 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01912-10, RP01912-20, RP01912-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Endoglin/ENG/CD105 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu27-Gly581) of Mouse ENG (Accession #NP_031958.2) fused with a His tag at the C-terminus.

Alternate Names: Endoglin, Cell surface MJ7/18 antigen, CD105, Eng, Edg

SWISS: Q63961

GeneID: 13805

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: ENG,Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis.Required for normal structure and integrity of adult vasculature.Regulates the migration of vascular endothelial cells.Required for normal extraembryonic angiogenesis and for embryonic heart development.May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis.May play a role in the binding of endothelial cells to integrins. Acts as a TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors.Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details