Skip to product information
1 of 1

ABclonal

Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein - RP01570

Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein - RP01570

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01570-10, RP01570-20, RP01570-50, RP01570-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Thr266) of mouse Ep-CAM/TROP-1/CD326 (Accession #NP_032558.2) fused with a 6×His tag at the C-terminus.

Alternate Names: 17-1A, 323/A3, ACSTD1, CD326, EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1, TROP1, EpCAM

SWISS: Q99JW5

GeneID: 17075

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Epithelial Cellular Adhesion Molecule (Ep-CAM), also known as EGP314, mEGP314, Protein 289A, Tumor-associated calcium signal transducer 1, CD326, belongs to the EPCAM family. Its ’ monomer subunit structureinteracts with phosphorylated CLDN7. Ep-CAM may act as a physical homophilic interaction molecule betweenintestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providingimmunological barrier as a first line of defense against mucosal infection. It plays a role in embryonic stem cellsproliferation and differentiation. It also up-regulates the expression of FABP5, MYC and cyclins A and E. Thepost-translational modification glycosylation at Asn-198 is crucial for protein stability.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details