ABclonal
Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein - RP01570
Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein - RP01570
Couldn't load pickup availability
Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01570-10, RP01570-20, RP01570-50, RP01570-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Thr266) of mouse Ep-CAM/TROP-1/CD326 (Accession #NP_032558.2) fused with a 6×His tag at the C-terminus.
Alternate Names: 17-1A, 323/A3, ACSTD1, CD326, EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1, TROP1, EpCAM
SWISS: Q99JW5
GeneID: 17075
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Epithelial Cellular Adhesion Molecule (Ep-CAM), also known as EGP314, mEGP314, Protein 289A, Tumor-associated calcium signal transducer 1, CD326, belongs to the EPCAM family. Its ’ monomer subunit structureinteracts with phosphorylated CLDN7. Ep-CAM may act as a physical homophilic interaction molecule betweenintestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providingimmunological barrier as a first line of defense against mucosal infection. It plays a role in embryonic stem cellsproliferation and differentiation. It also up-regulates the expression of FABP5, MYC and cyclins A and E. Thepost-translational modification glycosylation at Asn-198 is crucial for protein stability.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
