Skip to product information
1 of 1

ABclonal

Recombinant Mouse EphA2/ECK Protein - RP01472

Recombinant Mouse EphA2/ECK Protein - RP01472

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse EphA2/ECK Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01472-10, RP01472-20, RP01472-50, RP01472-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse EphA2/ECK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys26-Asn535) of mouse EphA2/Sek2 (Accession #NP_034269.2) fused with a 6×His tag at the C-terminus.

Alternate Names: Eck, Myk2, Sek2, Sek-2, AW545284, EphA2

SWISS: Q03145

GeneID: 13836

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Eph receptor A2 (Ephrin type-A receptor 2 or EphA2) is a member of the ephrin receptor subfamily of the protein-tyrosine kinase family.The receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse EphA2 (Catalog: RP01472) at 2 μg/mL (100 μL/well) can bind Human EFNA1 (Catalog: RP01425) with a linear range of 0.3 -4.27 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSAN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details