ABclonal
Recombinant Mouse Ephrin-B2/EFNB2 Protein - RP01468
Recombinant Mouse Ephrin-B2/EFNB2 Protein - RP01468
Couldn't load pickup availability
Recombinant Mouse Ephrin-B2/EFNB2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01468-10, RP01468-20, RP01468-50, RP01468-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Ephrin-B2/EFNB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg29-Ala232) of mouse Ephrin-B2/EFNB2 (Accession #NP_034241.2) fused with a 6×His tag at the C-terminus.
Alternate Names: Epl5, ELF-2, Eplg5, Htk-L, Lerk5, LERK-5, NLERK-1, EFNB2
SWISS: P52800
GeneID: 13642
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse EFNB2 at 1 μg/mL (100 μL/well) can bind Mouse EPHB2 with a linear range of 0.01-1.3 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
