Skip to product information
1 of 1

ABclonal

Recombinant Mouse EREG Protein - RP01880

Recombinant Mouse EREG Protein - RP01880

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse EREG Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01880-10, RP01880-20, RP01880-50, RP01880-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse EREG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val56-Leu101 ) of Mouse EREG (Accession #NP_031976.1) fused with hFc tag at the N-terminus.

Alternate Names: Proepiregulin, Cleaved into: Epiregulin, EPR, Ereg

SWISS: Q61521

GeneID: 13874

Species: Mouse

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Epiregulin (EREG) is a member of the epidermal growth factor family. Epiregulin (EREG) can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. Epiregulin (EREG) exhibit bifunctional regulatory properties: it inhibit the growth of several epithelial tumor cells and stimulated the growth of fibroblasts and various other types of cells. Epiregulin (EREG) bound to the EGF receptors of epidermoid carcinoma A431 cells much more weakly than did EGF, but was nevertheless much more potent than EGF as a mitogen for rat primary hepatocytes and Balb/c 3T3 A31 fibroblasts. These findings suggest that epiregulin (EREG) plays important roles in regulating the growth of epithelial cells and fibroblasts by binding to receptors for EGF-related ligands. Epiregulin (EREG) is the broadest specificity EGF-like ligand so far characterized: not only does it stimulate homodimers of both ErbB-1 and ErbB-4, it also activates all possible heterodimeric ErbB complexes.

Bio-Activity: Measured in a cell proliferation assay using Balb3T3 mouse fibroblast cells. The ED50 for this effect is 140.58-562.31 ng/mL, corresponding to a specific activity of 1.78×10^3 ~7.11×10^3 units/mg.

Source: HEK293 cells

Tag: N-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details