Skip to product information
1 of 1

ABclonal

Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein - RP01501

Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein - RP01501

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01501-10, RP01501-20, RP01501-50, RP01501-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr30-Pro210) of mouse Fc gamma RIIB/CD32b (Accession #NP_034317.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD32, CD32B, FCG2, FCGR2, IGFR2, Fcgr2b

SWISS: P08101

GeneID: 14130

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details