Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01501-10, RP01501-20, RP01501-50, RP01501-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr30-Pro210) of mouse Fc gamma RIIB/CD32b (Accession #NP_034317.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD32, CD32B, FCG2, FCGR2, IGFR2, Fcgr2b
SWISS: P08101
GeneID: 14130
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only