ABclonal
Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein - RP01394
Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein - RP01394
Couldn't load pickup availability
Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01394-10, RP01394-20, RP01394-50, RP01394-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Gln 203) of mouse Fc gamma RIV/CD16-2 (Accession #NP_653142.2) fused with a 6×His tag at the C-terminus.
Alternate Names: Fc gamma RIV, CD16-2, Fcgr4, FCGR4, mouse igg, FcgR4
SWISS: A0A0B4J1G0
GeneID: 246256
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: FcgammaRIV is a relatively new IgG Fc receptor (FcgammaR) that is reported to contribute to the pathogenesis of autoimmune diseases.FcgammaRIII and FcgammaRIV are each essential to trigger an FcRgamma-linker for activation of T-cell-dependent signal that drives C5a production in the Arthus reaction. A combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a anaphylatoxin receptor activation to generate inflammation.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
