Recombinant Mouse FGF-10 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01848-10, RP01848-20, RP01848-50, RP01848-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse FGF-10 Protein is produced by E. coli expression systerm. The target protein is expressed with sequence (Gln37-Thr209) of Mouse FGF-10 (Accession #NP_032028.1) fused with no tag.
Alternate Names: Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2, Fgf10
SWISS: O35565
GeneID: 14165
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Fibroblast Growth Factor 10 (FGF 10) is an evolutionary conserved secreted growth factor mediating mostly mesenchymal to epithelial signaling. FGF 10 belongs to the FGF 7 subfamily and shares similar biochemical and amino acid sequences with its constituent members (FGF3, FGF 7 and FGF 22). As a paracrine FGF, FGF 10 elicits its biological responses by activating the fibroblast growth factor receptor 2b (FGF R 2b), is crucial for governing proximal distal outgrowth as well as patterning and acts upstream of the known apical ectodermal ridge (AER) marker FGF 8. FGF10 is also implicated in pancreatic cancer, and that overexpression of FGFR2b is associated with metastatic invasion.
Bio-Activity: Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells. The ED50 for this effect is 3.66-14.64 ng/mL, corresponding to a specific activity of 56.83×10^4 ~2.73×10^5 units/mg.
Source: E. coli
Tag: NO-Tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mMPB,800mMNaCl, pH7.4
Antigen Sequence: QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only