Recombinant Mouse FGF-2/bFGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01345-10, RP01345-20, RP01345-50, RP01345-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of mouse FGF2/FGFB (Accession #NP_032032.1) fused with 6×His tag at the C-terminus.
Alternate Names: FGF2, BFGF, FGFB, FGF basic, HBGF-2, FGFb
SWISS: P15655
GeneID: 14173
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Basic fibroblast growth factor (bFGF), also known as FGF2, is a member of the fibroblast growth factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumour growth. Thus, bFGF is regarded as a target for cancers chemopreventive and therapeutic strategies.
Bio-Activity: Active Recombinant Mouse FGF2 was added during DP cell culture. The immunofluorescence identification showed that 1 ng/mL FGF2 could maintain the cellular characteristics of DP cells. The red part is the fluorescently labeled PDFGRA antibody, and the blue-cyan part is the DAPI-stained cells.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only