WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse FGF-21 Protein - RP01715

Recombinant Mouse FGF-21 Protein - RP01715

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse FGF-21 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01715-10, RP01715-20, RP01715-50, RP01715-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse FGF-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr30-Ser210) of mouse FGF-21 (Accession #NP_064397.1.) fused with and a 6×His tag at the C-terminus.

Alternate Names: Fgf8c; FGF21

SWISS: Q9JJN1

GeneID: 56636

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Fibroblast growth factor 21 (FGF21), which stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression. FGF21 has been shown to protect animals from diet-induced obesity when overexpressed in transgenic mice. It also lowers blood glucose and triglyceride levels when administered to diabetic rodents, suggesting it may exhibit the therapeutic characteristics necessary for effective treatment of diabetes. Treatment of animals with FGF21 results in increased energy expenditure, fat utilisation and lipid excretion. FGF21 is most abundantly expressed in the liver, and also expressed in the thymus at lower levels.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: YPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only