Skip to product information
1 of 1

ABclonal

Recombinant Mouse FGF-7/HBGF-7/KGF Protein - RP03172

Recombinant Mouse FGF-7/HBGF-7/KGF Protein - RP03172

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse FGF-7/HBGF-7/KGF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP03172-10, RP03172-20, RP03172-50, RP03172-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Recombinant Mouse FGF-7/HBGF-7/KGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys32-Thr194) of Mouse FGF-7/HBGF-7/KGF (Accession #NP_032034.1) fused with no tag.

Alternate Names: Fibroblast growth factor 7, FGF-7, Heparin-binding growth factor 7, Keratinocyte growth factor, Fgf7, Fgf-7, Kgf

SWISS: P36363

GeneID: 14178

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Fibroblast growth factor 7 (FGF7) is a member of the fibroblast growth factor (FGF) family of proteins. FGF7 plays an important role in regulating the proliferation, migration, and differentiation of cells. FGF7 is of stromal origin and produces a paracrine effect on epithelial cells. FGF7 is a mesenchyme-specific heparin-binding growth factor that binds FGF receptor 2 (FGFR2) to regulate numerous cellular and physiological processes. FGF7/FGFR2 promotes invasion and migration in human gastric cancer. FGF7 is specifically utilized as a paracrine factor during the process of differentiation of the epidermal layers in the regenerating scales and in particular for beta-cells differentiation. FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma, justifying its potential prognostic value for urothelial carcinoma.

Bio-Activity: Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human FGFR2b. The ED50 for this effect is typically 20-100 ng/mL

Source: E. coli

Tag: NO-Tag

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details