ABclonal
Recombinant Mouse FGF-9 Protein - RP01840LQ
Recombinant Mouse FGF-9 Protein - RP01840LQ
Couldn't load pickup availability
Recombinant Mouse FGF-9 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01840LQ-10, RP01840LQ-20, RP01840LQ-50, RP01840LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of Mouse FGF-9 (Accession #NP_038546.2) fused with NO-tag.
Alternate Names: Fibroblast growth factor 9, FGF-9, Glia-activating factor, GAF, HBGF-9, Fgf9, Fgf-9
SWISS: P54130
GeneID: 14180
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Fibroblast growth factor 9 is also known as FGF9, GAF, HBFG-9, SYNS3, and is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF9 is also a mitogen for oligodendrocyte type 2 astrocyte progenitor cells, smooth muscle cells, pheochromocytoma PC12 cells, and BALB/3T3 fibroblasts. However, unlike FGF acidic and basic, FGF9 has no effect on human umbilical vein endothelial cells, and it has been demonstrated that FGF9 binds preferentially to the IIIc form of FGFR3. Although no typical signal sequence was found in FGF9, it is secreted efficiently after synthesis not in a conventional manner. In nervous system, FGF9 is produced mainly by neurons and may plays an important role in CNS development. FGF9 has been shown to interact with Fibroblast growth factor receptor 3.
Bio-Activity: Measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 2.52-10.06 ng/mL, corresponding to a specific activity of 9.94×10^4 ~3.97×10^5 units/mg.
Source: E. coli
Tag: No-tag
Formulation: Supplied as a 0.22 μm filtered solution of solution of 20mM Tris-HCl, 250mM NaCl, 1mM EDTA, 20% Glycerol, 1mM DTT, pH 8.5
Antigen Sequence: MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
