Recombinant Mouse Flt3 ligand/Flt3L Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01058-10, RP01058-20, RP01058-50, RP01058-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Flt3 ligand/Flt3L Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Arg188) of mouse Flt-3 Ligand (Accession #NP_038548.3.) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: FLT3LG, FL, FLT3L, Flt3 ligand, FLT3LG
SWISS: P49772
GeneID: 14256
Species: Mouse
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse FLT3, His Tag at 3 μg/mL (100 μL/well) can bind Recombinant Mouse Flt-3 Ligand, The EC50 of Mouse Flt-3 Ligand is 36 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only