WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Follistatin/FST Protein - RP01047

Recombinant Mouse Follistatin/FST Protein - RP01047

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Follistatin/FST Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01047-10, RP01047-20, RP01047-50, RP01047-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Follistatin/FST Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Trp344) of mouse Follistatin (Accession #NP_001288302.1) fused with a 10×His tag at the C-terminus.

Alternate Names: AL033346, FS, Fst

SWISS: P47931-1

GeneID: 14313

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized recombinant Human Inhibin beta A at 0.5 μg/mL (100 μL/well) can bind recombinant Mouse FST, the EC50 of Mouse FST is 32.95 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only