Skip to product information
1 of 2

Elabscience

Recombinant Mouse G-CSF protein(N-His) - PKSM041499

Recombinant Mouse G-CSF protein(N-His) - PKSM041499

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse G-CSF protein(N-His) Sizes: 20μg, 100μg Catalogue Numbers: PKSM041499-20, PKSM041499-100 Citations, Manuals and MSDS Available upon request. Abbreviation: G-CSF Target Symptom: soluble Receptor Activator of NF-kB Ligand; TNFSF11; TRANCE (TNF-Related Activation-induced Cytokine); OPGL; ODF (Osteoclast Differentiation Factor); CD254; sRNAK Ligand Target Species: Mouse Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P09920 Accession: P09920 Background: Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to the IL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluated as a stem cell mobilizer and erythropoietin as a cytoprotective agent. Activity: Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is < 50 pg/mL. The specific activity of recombinant mouse G-CSF is > 2 x 107IU/mg. Sequence: MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 23.25 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details