Skip to product information
1 of 1

ABclonal

Recombinant Mouse HMGB1 Protein - RP01545

Recombinant Mouse HMGB1 Protein - RP01545

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse HMGB1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01545-10, RP01545-20, RP01545-50, RP01545-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse HMGB1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of mouse HMGB1 (Accession #NP_001300823.1) fused with a 6×His tag at the C-terminus.

Alternate Names: HMG-1, HMG1, HMG3, SBP-1, HMGB1

SWISS: P63158

GeneID: 15289

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: High-mobility group box 1 protein (HMGB1), also known as HMG-1 or amphoterin previously, is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3. Posttranslational modification of HMGB1, including acetylation, phosphorylation, and methylation, affects HMGB1 localization, receptor interactions, and bioactivity. HMGB1 can be localized to the nucleus or cytoplasm and can also be secreted despite its lack of a signal peptide. HMGB1 binds DNA in a non-sequence specific manner and may act as a structural cofactor during gene transcription.Acetylation of HMGB1 results in its cytoplasmic localization and eventual secretion. HMGB1 can be secreted by multiple cell types, and it is also released upon cell necrosis, apoptosis, and pyroptosis.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized mouse HMGB1 at 2 μg/ml (100 μl/well) can bind human AGER/RAGE(Catalog: RP00154) with a linear range of 0.25-91.96 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details