Recombinant Mouse ICOS/CD278 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01572-10, RP01572-20, RP01572-50, RP01572-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse ICOS/CD278 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Leu144) of mouse ICOS/CD278 (Accession #NP_059508.2) fused with a hFc tag at the C-terminus.
Alternate Names: ICOS, CD278, AILIM, CVID1, ICOS
SWISS: Q9WVS0
GeneID: 54167
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Inducible costimulator (ICOS), also called AILIM (Activation-Inducible Lymphocyte Immunomediatory Molecule) is a cell-surface receptor and belongs to the CD28 family of immune costimulatory receptors consisting of CD28, CTLA-4, and PD-1. The interaction of B7-H2/ICOS plays a critical role in Th cell differentiation, T/B cell interactions which are essential for the germinal center formation, and humoral immune responses, and as well as the production of cytokine IL-4. Also, ICOS is more potent in the induction of IL-10 production, a cytokine important for the suppressive function of T regulatory cells. The B7-1/B7-2--CD28/CTLA-4 and ICOS-B7RP-1 pathway provide key second signals that can regulate the activation, inhibition, and fine-tuning of T-lymphocyte responses. ICOS stimulates both Th1 and Th2 cytokine production but may have a preferential role in Th2 cell development. Moreover, The B7-1/B7-2-CD28/CTLA-4 and ICOS-B7RP-1 pathway has been suggested as being involved in the development of airway inflammation and airway hyperresponsiveness.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only