Elabscience
Recombinant Mouse IFN alpha 1a protein(N-His)(active) - PKSM041492
Recombinant Mouse IFN alpha 1a protein(N-His)(active) - PKSM041492
Regular price
$348.60 CAD
Regular price
Sale price
$348.60 CAD
Quantity
Couldn't load pickup availability
Recombinant Mouse IFN alpha 1a protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041492-20, PKSM041492-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: IFN alpha 1a
Target Symptom: FIL1 delta; IL-1F5; IL-1HY1; IL-1L1; IL-1RP3; IL-1ra Homolog 1; IL-1 delta
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P01572
Accession: P01572
Background: IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites, or tumor cells. They belong to the large class of glycoproteins known as cytokines. IFNs stimulate the production of two enzymes: a protein kinase and an oligoadenylate synthetase. They allow for communication between cells to trigger the protective defenses of the immune system that eradicate pathogens or tumors. IFNs can activate immune cells, such as natural killer cells and macrophages; they increase recognition of infection or tumor cells by up-regulating antigen presentation to T lymphocytes, and they also increase the ability of uninfected host cells to resist new infection by the virus. Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has antiviral activities.
Activity: Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 107IU/mg.
Sequence: MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 22.47 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
View full details
