Skip to product information
1 of 1

ABclonal

Recombinant Mouse IFN-alpha 4 Protein - RP00756

Recombinant Mouse IFN-alpha 4 Protein - RP00756

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IFN-alpha 4 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00756-10, RP00756-20, RP00756-50, RP00756-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-alpha 4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu23-Glu186) ofMouse IFN-alpha 4(Accession #NP_034634.1) fused with His tag at the C-Terminus.

Alternate Names: Ifna4, Interferon alpha-4, IFN-alpha-4

SWISS: P07351

GeneID: 15967

Species: Mouse

Purity: ≥ 95% as determined by reducing SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The interferons (IFN) are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, and are classified based on their binding specificity to cell surface receptors. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 ( alpha -subunit) and IFNAR2 ( beta -subunit). This binding contributes to TNF-alpha induced signaling.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: LGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE

Endotoxin: < 0.01 EU/μg of the protein by LAL method.

Research Use Only

View full details