WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IFN-alpha 5 Protein - RP00759

Recombinant Mouse IFN-alpha 5 Protein - RP00759

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IFN-alpha 5 Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP00759-10, RP00759-50, RP00759-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-alpha 5 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 5(Accession #NP_034635.2) fused with His tag at the C-Terminus.

Alternate Names: Ifna5, If1ai12, Interferon 1ai12, Interferon alpha 5

SWISS: Q810G2

GeneID: 15968

Species: Mouse

Purity: ≥ 90% as determined by reducing SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IFN-alpha 5 belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE

Endotoxin: < 0.01 EU/μg of the protein by LAL method.

Research Use Only