ABclonal
Recombinant Mouse IFN-alpha 5 Protein - RP00759
Recombinant Mouse IFN-alpha 5 Protein - RP00759
Couldn't load pickup availability
Recombinant Mouse IFN-alpha 5 Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP00759-10, RP00759-50, RP00759-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IFN-alpha 5 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu189) of Mouse IFN-alpha 5(Accession #NP_034635.2) fused with His tag at the C-Terminus.
Alternate Names: Ifna5, If1ai12, Interferon 1ai12, Interferon alpha 5
SWISS: Q810G2
GeneID: 15968
Species: Mouse
Purity: ≥ 90% as determined by reducing SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IFN-alpha 5 belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE
Endotoxin: < 0.01 EU/μg of the protein by LAL method.
Research Use Only
