ABclonal
Recombinant Mouse IFN-alpha 7/IFNA7 Protein - RP01975
Recombinant Mouse IFN-alpha 7/IFNA7 Protein - RP01975
Couldn't load pickup availability
Recombinant Mouse IFN-alpha 7/IFNA7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01975-10, RP01975-20, RP01975-50, RP01975-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IFN-alpha 7/IFNA7 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu190) of Mouse IFN-alpha 7/IFNA7(Accession #P06799) fused with His at the C-Terminus.
Alternate Names: Ifna7, If1ai9, Ifna14, Interferon 1ai9, Interferon alpha 7
SWISS: P06799
GeneID: 15970
Species: Mouse
Purity: ≥ 95% as determined by reducing SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IFN are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Mature mouse IFNA7 consists of 166 aa and shares 59% identity with human IFNA7. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA7 showing slightly lower antiviral potency against Mengo virus but maintaining similar anti-proliferative potency in B16 melanoma cells.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
