Skip to product information
1 of 1

ABclonal

Recombinant Mouse IFN-alpha 7/IFNA7 Protein - RP01975

Recombinant Mouse IFN-alpha 7/IFNA7 Protein - RP01975

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IFN-alpha 7/IFNA7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01975-10, RP01975-20, RP01975-50, RP01975-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-alpha 7/IFNA7 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu190) of Mouse IFN-alpha 7/IFNA7(Accession #P06799) fused with His at the C-Terminus.

Alternate Names: Ifna7, If1ai9, Ifna14, Interferon 1ai9, Interferon alpha 7

SWISS: P06799

GeneID: 15970

Species: Mouse

Purity: ≥ 95% as determined by reducing SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IFN are a family of cytokines with potent antiviral, antiproliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Mature mouse IFNA7 consists of 166 aa and shares 59% identity with human IFNA7. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFN alpha subtypes are known to display unique efficacies to viral protection, with IFNA7 showing slightly lower antiviral potency against Mengo virus but maintaining similar anti-proliferative potency in B16 melanoma cells.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).

Antigen Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details