WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IFN-beta Protein - RP01076

Recombinant Mouse IFN-beta Protein - RP01076

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IFN-beta Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01076-10, RP01076-20, RP01076-50, RP01076-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Asn182) of mouse Interferon beta (Accession #NP_034640.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: Fibroblast interferon, IFBIFNB, IFF, IFNB1, IFNbeta, IFN-beta, interferon beta, , IFNB

SWISS: P01575

GeneID: 15977

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only